Analytical Data
-
Gene name
VSIG8
- Application
-
Biological Activity
Measured by its ability to chemoattract Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.7887 μg/ml, corresponding to a specific activity is 1267.91 units/mg. Measured by its ability to chemoattract Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.7887 μg/mL, corresponding to a specific activity is 1267.91 units/mg.
-
Alternative Names
V-set and immunoglobulin domain-containing protein 8; Vsig8
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q6P3A4-1
-
Expression Region
V22-G262
-
AA Sequence
VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG
-
Protein Length
Extracellular Domain
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TREM-2 (Triggering Receptor Expressed on Myeloid Cells 2) is a receptor predominantly expressed on myeloid cells, notably microglia in the central nervous system. Its significance has surged in recent years due to its association with neurodegenerative diseases, particularly Alzheimer's disease. Genetic variants of TREM-2 have been linked to an increased risk of Alzheimer's, highlighting its role in microglial activation and immune response in the brain. Research has revealed that TREM-2 is crucial for the maintenance of microglial homeostasis and functions, influencing inflammatory responses and phagocytic activity. The interest in TREM-2 recombinant protein lies in its potential therapeutic applications. By understanding the mechanisms of TREM-2 signaling and its interactions with ligands, researchers are investigating how modulation of TREM-2 activity could enhance microglial function, potentially leading to improved outcomes in neurodegenerative conditions. Furthermore, recombinant TREM-2 protein can be used as a tool for studying its role in cellular pathways and for probing its function in immune regulation. Overall, the ongoing research into TREM-2 not only aims to elucidate its biological significance but also seeks to pave the way for innovative therapeutic strategies targeting neuroinflammation and neurodegeneration.
