Analytical Data
-
Gene name
Sting1
- Application
-
Alternative Names
Sting1; Eris; Mita; Mpys; Tmem173; Stimulator of interferon genes protein; mSTING; Endoplasmic reticulum interferon stimulator; ERIS; Mediator of IRF3 activation; MMITA; Transmembrane protein 173
-
Species
Mouse
-
Source
E. coli
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3TBT3
-
Expression Region
M1-I378
-
AA Sequence
MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI
-
Protein Length
full length
-
Molecular Weight
45 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Sting1, or Stimulator of Interferon Genes, is a critical player in the innate immune response, particularly in the detection of cytosolic DNA and the subsequent activation of type I interferons. The protein serves as a key regulator in the signaling pathways that lead to the activation of transcription factors, resulting in the expression of various immune-related genes. Dysregulation of Sting1 has been implicated in several autoimmune diseases, cancer, and viral infections, making it a target of interest for therapeutic interventions. Recent advancements in molecular biology techniques have enabled the production of recombinant Sting1 proteins, allowing researchers to study its structural properties, interaction with other signaling molecules, and functional roles in immune modulation. Understanding the mechanism of Sting1 activation and its downstream effects holds promise for the development of novel immunotherapies and vaccines, highlighting its significance in both basic research and clinical applications. The exploration of Sting1's role in various pathological conditions continues to be a vibrant area of research, offering insights into the interplay between innate immunity and disease.











