Analytical Data
-
Gene name
S100A8-S100A9
- Application
-
Species
Mouse
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P27005 (P2-E89) (S100A8) & P31725 (A2-K113)
-
Expression Region
P27005 (P2-E89) (S100A8)&P31725 (A2-K113) (S100A9)
-
AA Sequence
S100A8: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE S100A9: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
-
Molecular Weight
11&12.9 kDa
-
Endotoxin
<1 EU/μg, determined by LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
S100A8 and S100A9 are calcium-binding proteins belonging to the S100 family, known for their roles in various cellular processes including inflammation, cell differentiation, and apoptosis. These proteins often form a heterodimer, S100A8-S100A9, which has garnered significant attention in recent years due to its involvement in the pathogenesis of several inflammatory diseases and cancer. Elevated levels of this complex have been observed in conditions such as rheumatoid arthritis, inflammatory bowel disease, and tumors, highlighting its potential as a biomarker for disease activity and severity. The S100A8-S100A9 complex functions as a damage-associated molecular pattern (DAMP), actively participating in the recruitment and activation of immune cells, which can exacerbate inflammatory responses. Due to its critical role in inflammation and immunity, research has focused on the therapeutic potential of targeting S100A8-S100A9 in various diseases. Recombinant proteins of S100A8 and S100A9 have been developed to facilitate in vivo studies aimed at understanding their biological functions and therapeutic implications. These studies are essential in elucidating the mechanisms by which S100A8-S100A9 contributes to disease processes, thereby informing potential strategies for intervention and treatment in inflammatory and oncological contexts. Moreover, understanding the structural properties and interactions of S100A8-S100A9 may pave the way for the development of novel therapeutic agents that can modulate their activity, providing new avenues for medical research.
