Analytical Data
-
Gene name
STK11
-
简介
The STK11 protein is a tumor suppressor kinase that complexly regulates members of the AMP-activated protein kinase (AMPK) family, affecting cellular processes such as metabolism, apoptosis, and DNA damage responses. It phosphorylates the T-loop of AMPK family proteins and activates PRKAA1, PRKAA2 and other proteins (except MELK). STK11 Protein, Human (His-SUMO) is the recombinant human-derived STK11 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Application
-
Biological Activity
Immobilized Human STK11 at 2 μg/mL (100 μL/well) can bind STK11 antibody, The ED50 for this effect is 8.246 ng/mL. Immobilized Human STK11 at 2 μg/mL (100 μL/well) can bind STK11 antibody, The ED50 for this effect is 8.246 ng/mL.
-
Species
Human
-
Source
E. coli
-
Tag
N-SUMO;N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15831
-
Expression Region
M1-C430
-
AA Sequence
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSAC
-
Protein Length
Partial
-
Molecular Weight
60-72 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STK11, also known as LKB1, is a serine/threonine kinase that plays a crucial role in regulating cell growth, metabolism, and polarity. Mutations in the STK11 gene are linked to Peutz-Jeghers syndrome, a hereditary condition characterized by gastrointestinal polyps and an increased risk of various cancers, particularly breast, pancreatic, and colorectal cancers. Research into STK11 recombinant protein has gained significant attention due to its potential as both a biomarker and a therapeutic target. By studying the structural and functional properties of STK11, researchers aim to understand its role in cancer biology and the downstream signaling pathways it influences, such as the AMP-activated protein kinase (AMPK) pathway, which is essential for cellular energy homeostasis. Furthermore, the development of STK11 recombinant protein not only facilitates in vitro and in vivo studies of its biological functions but also supports drug discovery efforts aimed at modulating its activity. Understanding STK11's functional mechanisms and its interactions with other cellular proteins can illuminate novel therapeutic strategies for treating STK11-related diseases. As such, investigating STK11 recombinant protein serves as a critical endeavor in the broader context of cancer research and therapeutic development.
