Cat: IPD-X25397

Recombinant Human RCN1 Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RCN1

  • 简介

    RCN1 protein may regulate calcium-dependent activities in the endoplasmic reticulum (ER) lumen or post-ER compartment. The specific mechanisms by which it affects calcium-dependent processes need to be further elucidated to facilitate research into its functional significance. RCN1 Protein, Human (P.pastoris, His) is the recombinant human-derived RCN1 protein, expressed by P. pastoris , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Epididymis secretory protein Li 84; RCN 1; RCN; rcn1; Reticulocalbin 1; Reticulocalbin-1; Reticulocalbin1

  • Species

    Human

  • Source

    P. pastoris

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15293-1

  • Expression Region

    31P-L331

  • AA Sequence

    PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

  • Protein Length

    Partial

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RCN1, or RCN1 protein, is a crucial component in cellular calcium signaling and homeostasis, playing a significant role in various physiological processes, including muscle contraction, neurotransmitter release, and gene expression. The RCN1 gene encodes a protein that belongs to the family of calmodulin-like proteins, which interact with calcium ions and various target proteins, thus participating in the regulation of intracellular calcium levels. Research into RCN1 recombinant protein has gained prominence due to its potential implications in understanding diseases associated with calcium dysregulation, such as neurodegenerative disorders, cardiovascular diseases, and certain types of cancer. Moreover, the ability to produce RCN1 in a recombinant form facilitates in-depth biochemical and structural studies, enabling researchers to explore its functional mechanisms and interactions at the molecular level. The development of RCN1 recombinant protein offers insights into its role in cellular signaling pathways and aids in the identification of therapeutic targets for conditions where calcium signaling is altered. Thus, RCN1 is not only a critical protein for maintaining cellular calcium balance but also a promising candidate for further studies that could lead to innovative treatment strategies. As research progresses, understanding RCN1's precise functions and its interactions within complex biological systems is expected to contribute significantly to the fields of cell biology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US