Cat: IPD-X11799

Recombinant Mouse BDNF Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BDNF

  • 简介

    BDNF protein is an important signaling molecule that activates NTRK2 downstream cascades and affects multiple roles in neuronal development and function. It promotes survival and differentiation of the peripheral and central nervous system, affecting axonal and dendritic growth. BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) is the recombinant mouse-derived BDNF protein, expressed by HEK293 , with C-6*His labeled tag and R129A, R130A mutation.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Recombinant Mouse BDNF at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TrkB. The ED50 for this effect is <100 ng/mL. Immobilized Recombinant Mouse BDNF at 1 μg/ml (100 μL/well) can bind Biotinylated Recombinant Mouse TrkB. The ED50 for this effect is 91.22 ng/mL.

  • Alternative Names

    Brain-derived neurotrophic factor; BDNF; ProBDNF

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P21237-1

  • Expression Region

    A19-R249, R129A, R130A

  • AA Sequence

    APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    35-40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Brain-derived neurotrophic factor (BDNF) is a crucial neurotrophic protein that plays a significant role in neuronal survival, differentiation, and synaptic plasticity, making it essential for cognitive function and mental health. Abnormalities in BDNF signaling are implicated in various neurological and psychiatric disorders, including depression, schizophrenia, and neurodegenerative diseases like Alzheimer's. Given its vital functions, BDNF has become a focal point in biomedical research, particularly regarding its therapeutic potential. The exploration of BDNF recombinant proteins has gained momentum as researchers aim to harness its beneficial effects in treating conditions characterized by neurotrophic deficits. The ability to produce recombinant BDNF allows for the study of its properties in vitro and in vivo, providing valuable insights into its mechanisms of action and potential applications in therapy. Various expression systems, such as bacteria, yeast, and mammalian cells, have been employed to produce functional BDNF. However, challenges remain in ensuring proper folding, post-translational modifications, and bioactivity of the recombinant protein. Understanding these aspects can help optimize BDNF-based therapies and develop novel strategies for promoting brain health and recovery in individuals suffering from neurological impairments. As the field advances, ongoing research into the production, delivery, and efficacy of BDNF recombinant proteins holds promise for unlocking new avenues for treating a range of neurodevelopmental and neurodegenerative disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US