Analytical Data
-
Gene name
BDNF
-
简介
BDNF protein is an important signaling molecule that activates NTRK2 downstream cascades and affects multiple roles in neuronal development and function. It promotes survival and differentiation of the peripheral and central nervous system, affecting axonal and dendritic growth. BDNF Protein, Mouse (R129A, R130A, HEK293, C-His) is the recombinant mouse-derived BDNF protein, expressed by HEK293 , with C-6*His labeled tag and R129A, R130A mutation.
- Application
-
Biological Activity
Immobilized Recombinant Mouse BDNF at 1 μg/mL (100 μL/well) can bind Biotinylated Recombinant Mouse TrkB. The ED50 for this effect is <100 ng/mL. Immobilized Recombinant Mouse BDNF at 1 μg/ml (100 μL/well) can bind Biotinylated Recombinant Mouse TrkB. The ED50 for this effect is 91.22 ng/mL.
-
Alternative Names
Brain-derived neurotrophic factor; BDNF; ProBDNF
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
P21237-1
-
Expression Region
A19-R249, R129A, R130A
-
AA Sequence
APMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
35-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Brain-derived neurotrophic factor (BDNF) is a crucial neurotrophic protein that plays a significant role in neuronal survival, differentiation, and synaptic plasticity, making it essential for cognitive function and mental health. Abnormalities in BDNF signaling are implicated in various neurological and psychiatric disorders, including depression, schizophrenia, and neurodegenerative diseases like Alzheimer's. Given its vital functions, BDNF has become a focal point in biomedical research, particularly regarding its therapeutic potential. The exploration of BDNF recombinant proteins has gained momentum as researchers aim to harness its beneficial effects in treating conditions characterized by neurotrophic deficits. The ability to produce recombinant BDNF allows for the study of its properties in vitro and in vivo, providing valuable insights into its mechanisms of action and potential applications in therapy. Various expression systems, such as bacteria, yeast, and mammalian cells, have been employed to produce functional BDNF. However, challenges remain in ensuring proper folding, post-translational modifications, and bioactivity of the recombinant protein. Understanding these aspects can help optimize BDNF-based therapies and develop novel strategies for promoting brain health and recovery in individuals suffering from neurological impairments. As the field advances, ongoing research into the production, delivery, and efficacy of BDNF recombinant proteins holds promise for unlocking new avenues for treating a range of neurodevelopmental and neurodegenerative disorders.











