Analytical Data
-
Gene name
TEAD4
-
简介
TEAD4 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD4 Protein, Human (His) is the recombinant human-derived TEAD4 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15561
-
Expression Region
M74-E434
-
AA Sequence
MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
-
Protein Length
Partial
-
Molecular Weight
44.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEAD4 (TEA Domain Family Member 4) is a transcription factor that plays a critical role in various biological processes, including cell proliferation, differentiation, and organ development. Operating largely within the Hippo signaling pathway, TEAD4 regulates gene expression in response to cellular context, initially identified for its function in promoting stem cell maintenance and tumorigenesis. The interest in TEAD4 has surged due to its implications in cancer research, particularly in understanding how dysregulation of the Hippo pathway contributes to uncontrolled cell growth. Furthermore, TEAD4 has been implicated in various developmental processes such as cardiac and neuronal differentiation. Research into TEAD4 recombinant proteins has gained momentum as these proteins can serve as valuable tools for elucidating the molecular mechanisms underlying its function. By studying TEAD4 in detail, including its interactions with other proteins and target genes, scientists aim to uncover potential therapeutic targets for cancers resulting from Hippo pathway dysregulation. Additionally, TEAD4's role in stem cell biology makes it a candidate for regenerative medicine studies. Generating recombinant TEAD4 proteins allows researchers to perform assays that investigate its binding affinities, transcriptional activation capabilities, and interactions with other signaling pathways. This line of research not only enhances the understanding of TEAD4's biological roles but also fosters the development of novel strategies for disease intervention, particularly in cancer therapy and regenerative medicine.
