Cat: IPD-X33124

Recombinant Rat PDGF R alpha Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDGF R alpha

  • 简介

    PDGF R alpha protein is a tyrosine protein kinase receptor for PDGFA, PDGFB, and PDGFC that coordinates embryonic development, cell proliferation, survival, and chemotaxis. Their functions vary, promoting or inhibiting cell proliferation and migration depending on the situation. PDGF R alpha Protein, Rat (HEK293, His) is the recombinant rat-derived PDGF R alpha protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit the biological activity of PDGF-AA using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 0.6932 μg/mL in the presence of 100 ng/mL recombinant human PDGF-AA, corresponding to a specific activity is 1.443×103 U/mg. Measured by its ability to inhibit the biological activity of PDGF-AA using NIH-3T3 mouse fibroblast cells. The ED50 for this effect is 0.6932 μg/mL in the presence of 100 ng/mL recombinant human PDGF-AA, corresponding to a specific activity is 1.443×103U/mg.

  • Alternative Names

    Platelet-derived growth factor receptor alpha; PDGFR-alpha; PDGFR-2; CD140a; PDGFRA

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    NP_036934.1

  • Expression Region

    L24-E523

  • AA Sequence

    LLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPMSEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYVPDPDMAFVPLGMTDSLVIVEEDDSAIIPCLTTDPDTEVTLHNNGRLVPASYDSRQGFNGTFSVGPYICEATVRGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNNEVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGDYECAARQATKEVKEMKTVTISVHEKGFVQIRPTFGHLETVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENLTEITTDVQRSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDMKSYTFELSTLVPASILELVDDHHGSGGGQTVRCTAEGTPLPNIEWMICKDIKKCNNDTSWTVLASNVSNIITEFHQRGRSTVEGRVSFAKVEETIAVRCLAKNDLGIGNRELKLVAPSLRSE

  • Protein Length

    Partial

  • Molecular Weight

    70-115 kDa due to glycosylation

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Platelet-Derived Growth Factor Receptor Alpha (PDGFR-α) is a receptor tyrosine kinase that plays a pivotal role in cellular processes such as proliferation, survival, and migration, particularly in mesenchymal cells. Its activation by platelet-derived growth factors is essential for normal physiological processes, including wound healing and tissue repair. However, aberrant PDGFR-α signaling has been implicated in various pathological conditions, including fibrosis, atherosclerosis, and various types of cancer, prompting significant interest in this receptor as a therapeutic target. The generation of recombinant PDGFR-α proteins has allowed researchers to study the structure-function relationships of the receptor, investigate its signaling pathways, and develop potential inhibitors. This recombinant protein serves as a valuable tool in elucidating the molecular mechanisms underlying PDGFR-α function and its contributions to disease pathogenesis. Moreover, understanding the interactions between PDGFR-α and its ligands at the molecular level may provide insights into the development of novel therapeutic strategies to combat diseases associated with dysregulated PDGFR-α activity. Thus, ongoing research on PDGFR-α recombinant proteins is vital to advancing our knowledge of its biological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US