Cat: IPD-X25256

Recombinant Human HLA-DRB1 Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HLA-DRB1

  • 简介

    HLA-DRB1 protein, as the beta chain of MHCII, guides T cell recognition, orchestrates immune responses against pathogens and tumors, and adapts its antigen presentation in the tumor microenvironment, ensuring a diverse role in immune responses and tolerance mechanisms, notably influenced by specific alleles like DRB1*01:01. HLA-DRB1 Protein, Human (Myc, His-SUMO) is the recombinant human-derived HLA-DRB1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HLA class II histocompatibility antigen, DRB1 beta chain; Human leukocyte antigen DRB1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His;C-Myc;N-SUMO

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01911

  • Expression Region

    G30-K227

  • AA Sequence

    GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HLA-DRB1, a crucial gene in the human leukocyte antigen (HLA) system, encodes a part of the major histocompatibility complex (MHC) class II molecule, which plays a vital role in the immune response by presenting peptides to CD4+ T cells. Variations and polymorphisms in the HLA-DRB1 gene are associated with susceptibility to various autoimmune diseases, including rheumatoid arthritis, multiple sclerosis, and type 1 diabetes, making it a significant focus of research in immunology and genetics. The recombinant protein of HLA-DRB1 serves as a valuable tool for studying the structural and functional aspects of this molecule, understanding its interaction with different peptides, and elucidating the molecular mechanisms underlying immune responses. Moreover, the expression of recombinant HLA-DRB1 can facilitate the development of therapeutic strategies, including vaccine design and immunotherapies, by providing insights into how variations in this gene influence disease risk and progression. Through advanced techniques such as recombinant DNA technology and protein engineering, researchers aim to produce high-quality HLA-DRB1 proteins for detailed analysis, which can ultimately contribute to personalized medicine approaches in treating autoimmune conditions and improving transplant outcomes. Thus, the study of HLA-DRB1 recombinant proteins not only enhances our understanding of basic immunological processes but also holds promise for translational applications in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US