Analytical Data
-
Gene name
Beta-NGF
-
简介
Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01138
-
Expression Region
E19-A241
-
AA Sequence
EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Beta-Nerve Growth Factor (Beta-NGF) is a critical neurotrophic factor that plays a vital role in the survival, development, and maintenance of neurons. Its significance was first highlighted in the context of the nervous system, where it promotes neuronal differentiation and repair, making it a focus of interest for neurodegenerative disease research and nerve injury therapies. Recent studies have demonstrated that Beta-NGF not only influences neuronal health but also impacts various non-neuronal cells, suggesting broader biological functions. The recombinant production of Beta-NGF has emerged as a promising approach to study its mechanisms of action and therapeutic potential. Advances in recombinant DNA technology have facilitated the generation of bioactive Beta-NGF, which can be utilized in preclinical studies to explore its effects on neuronal growth and survival. Furthermore, the protein's involvement in pain pathways has led to investigations into its potential as a target for pain management. The exploration of Beta-NGF's role in cell signaling, its interactions with receptors, and its implications for tissue regeneration continues to drive research efforts, ultimately aiming to develop innovative treatments for conditions like Alzheimer's disease, peripheral neuropathy, and other neural injuries.
