Cat: IPD-X11774

Recombinant Human Beta-NGF Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Beta-NGF

  • 简介

    Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Beta-Nerve Growth Factor; Beta-NGF; NGF; NGFB

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01138

  • Expression Region

    E19-A241

  • AA Sequence

    EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Beta-Nerve Growth Factor (Beta-NGF) is a critical neurotrophic factor that plays a vital role in the survival, development, and maintenance of neurons. Its significance was first highlighted in the context of the nervous system, where it promotes neuronal differentiation and repair, making it a focus of interest for neurodegenerative disease research and nerve injury therapies. Recent studies have demonstrated that Beta-NGF not only influences neuronal health but also impacts various non-neuronal cells, suggesting broader biological functions. The recombinant production of Beta-NGF has emerged as a promising approach to study its mechanisms of action and therapeutic potential. Advances in recombinant DNA technology have facilitated the generation of bioactive Beta-NGF, which can be utilized in preclinical studies to explore its effects on neuronal growth and survival. Furthermore, the protein's involvement in pain pathways has led to investigations into its potential as a target for pain management. The exploration of Beta-NGF's role in cell signaling, its interactions with receptors, and its implications for tissue regeneration continues to drive research efforts, ultimately aiming to develop innovative treatments for conditions like Alzheimer's disease, peripheral neuropathy, and other neural injuries.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US