Cat: IPD-X33103

Recombinant Human VEGFR-1 Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VEGFR-1

  • 简介

    The VEGFR-1 protein is a tyrosine protein kinase that acts as a cell surface receptor for VEGFA, VEGFB, and PGF. It plays a crucial role in embryonic vasculature development, regulation of angiogenesis, cell survival, migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR-1 Protein, Human (328a.a, HEK293, Fc) is the recombinant human-derived VEGFR-1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Vascular endothelial growth factor receptor 1; FLT; FLT1; FRT; VEGFR-1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P17948-4

  • Expression Region

    S27-I328

  • AA Sequence

    MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI

  • Protein Length

    Partial

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Vascular Endothelial Growth Factor Receptor 1 (VEGFR-1) is a critical receptor involved in angiogenesis, the formation of new blood vessels from pre-existing ones, which plays a significant role in various physiological and pathological processes, including cancer progression, tissue repair, and embryonic development. The overexpression of VEGFR-1 has been associated with tumor growth and metastasis, making it a potential target for cancer therapy. Research on recombinant VEGFR-1 proteins has surged as scientists aim to better understand its structure, function, and mechanisms of action. These studies often involve the production of recombinant VEGFR-1 proteins in various expression systems, allowing for in-depth analysis of their biochemical properties, ligand-binding abilities, and downstream signaling pathways. By elucidating the interactions between VEGFR-1 and its ligands, researchers hope to identify novel therapeutic strategies, including monoclonal antibodies or small-molecule inhibitors that can disrupt VEGFR-1 signaling, potentially leading to improved clinical outcomes in cancer treatment and other diseases linked to aberrant angiogenesis. Moreover, recombinant VEGFR-1 proteins serve as valuable tools for screening and development of anti-angiogenic drugs, providing insights into their efficacy and safety profiles. Overall, the study of recombinant VEGFR-1 not only enhances our understanding of vascular biology but also opens avenues for innovative therapeutic approaches targeting angiogenesis-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US