Recombinant Staphylococcus aureus MecA Protein，His & SUMO

MecA

The MecA protein plays a crucial role in cellular machinery by facilitating the recognition and targeting of unfolded and aggregated proteins, directing them to the ClpC protease or other proteins involved in proteolysis. The function of this protein is critical for the efficient removal and degradation of abnormal proteins, ensuring cellular homeostasis and preventing the accumulation of potentially harmful protein aggregates. MecA Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived MecA protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

mecA; MW0880Adapter protein MecA

Staphylococcus aureus

E. coli

N-His;N-SUMO

Greater than 90% as determined by SDS-PAGE.

P60186

M1-E239

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Full Length

44 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.