Analytical Data
-
Gene name
ITGBL1
-
简介
Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.
- Application
-
Alternative Names
ITGBL1; OSCP; TIED; Integrin beta-like protein 1; Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein
-
Species
Human
-
Source
E. coli
-
Tag
C-Myc;N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95965
-
Expression Region
V24-P494
-
AA Sequence
VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
67 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITGBL1, or Integrin Beta-Like Protein 1, is a member of the integrin family, which plays a crucial role in mediating cellular adhesion and communication within the extracellular matrix. Research into ITGBL1 has gained attention due to its potential involvement in various physiological and pathological processes, such as cell migration, differentiation, and tissue remodeling. Studies have indicated that ITGBL1 may be implicated in cancer progression, inflammation, and fibrosis, suggesting that it could serve as a biomarker for certain diseases or as a therapeutic target. The recombinant production of ITGBL1 protein allows for detailed analysis of its structure and function, facilitating the exploration of its role in cell signaling pathways and interactions with other proteins. Moreover, the ability to produce ITGBL1 in a laboratory setting opens avenues for developing novel therapeutic strategies and diagnostic tools. Understanding the mechanisms by which ITGBL1 influences cellular behavior could provide insights into its potential as a target for interventions in diseases where integrin signaling is dysregulated. Overall, ongoing research into ITGBL1 and its recombinant variants holds promise not only for advancing our knowledge of cellular dynamics but also for developing targeted treatments for conditions linked to integrin-mediated pathways.











