Analytical Data
-
Gene name
ZBTB17
-
简介
The ZBTB17 protein is a multifunctional transcription factor that functions as a binding partner-based activator or repressor and a targeted regulator of cell cycle progression. It is essential for early lymphocyte development, preventing apoptosis and ensuring lineage commitment. ZBTB17 Protein, Human (His) is the recombinant human-derived ZBTB17 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Zinc Finger and BTB Domain-Containing Protein 17; Myc-Interacting Zinc Finger Protein 1; Miz-1; Zinc Finger Protein 151; Zinc Finger Protein 60; ZBTB17; MIZ1; ZNF151; ZNF60
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13105
-
Expression Region
M1-A188
-
AA Sequence
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADA
-
Protein Length
Partial
-
Molecular Weight
18.0-26.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZBTB17, a member of the ZBTB (zinc finger and BTB domain-containing) family of proteins, has garnered significant interest due to its potential role in various biological processes, including transcriptional regulation, cell differentiation, and immune responses. It is implicated in the regulation of gene expression and chromatin remodeling, which are critical for maintaining cellular homeostasis and lineage specificity. Recent studies have suggested that ZBTB17 may also play a role in cancer biology, particularly in the maintenance of cancer stem cells and tumor progression. Understanding its structure and function through recombinant protein studies is essential for elucidating its biological roles. The ability to produce ZBTB17 as a recombinant protein allows researchers to investigate its interactions with DNA, other proteins, and cellular pathways in a controlled environment. Furthermore, exploring the post-translational modifications of ZBTB17 can provide insights into its regulation and functional implications in health and disease. The study of ZBTB17 not only advances our knowledge of fundamental biological mechanisms but also offers potential therapeutic avenues for targeting its dysregulation in cancer and other diseases. As such, the production and characterization of ZBTB17 recombinant protein are critical steps in this ongoing research endeavor.
