Cat: IPD-X29577

Recombinant Human CCN5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CCN5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCN family member 5; CCN5; CT58; CTGFL; WISP2; UNQ228/PRO261; Connective tissue growth factor-like protein; Connective tissue growth factor-related protein 58; WNT1-inducible-signaling pathway protein 2; WISP-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O76076

  • Expression Region

    M1-F250

  • AA Sequence

    MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

  • Protein Length

    Full Length

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CCN5, also known as connective tissue growth factor (CTGF) family member 5, is a member of the CCN (Cyr61, CTGF, NOV) family of matricellular proteins, which are implicated in various biological processes, including cell adhesion, migration, proliferation, and extracellular matrix regulation. Research into CCN5 has gained momentum due to its potential role in cellular signaling pathways that influence tissue repair and fibrosis, particularly in cardiovascular disease, cancer, and metabolic disorders. Studies have indicated that CCN5 may play a protective role against cardiac hypertrophy and fibrosis, suggesting its involvement in cardiac health. Furthermore, aberrant expression of CCN5 has been linked to tumor progression and metastasis, making it a critical target for cancer research. The recombinant production of CCN5 protein allows for detailed functional studies and characterization of its molecular mechanisms. Understanding the structure-function relationship of CCN5 can unveil its therapeutic potential, thereby highlighting the importance of developing reliable methods for its recombinant expression and purification. This knowledge may open doors for new interventions in diseases where CCN5 is dysregulated, further emphasizing the need for comprehensive research on this protein in various biological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US