Analytical Data
-
Gene name
LOX
-
简介
LOX proteins play a critical role in the post-translational oxidative deamination of peptidyl lysine residues in collagen and elastin precursors, thereby shaping extracellular matrix dynamics. It regulates Ras expression, suggesting potential tumor suppressive effects, affecting cellular homeostasis and cancer-related processes. LOX Protein, Human (C-His) is the recombinant human-derived LOX protein, expressed by E. coli, with C-6*His labeled tag.
- Application
-
Alternative Names
LOX; Protein-lysine 6-oxidase; Lysyl oxidase
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28300
-
Expression Region
P174-Y417
-
AA Sequence
PYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
-
Protein Length
Partial
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOX (Lysyl oxidase) is a copper-dependent enzyme that plays a crucial role in the cross-linking of collagen and elastin, thereby influencing the structural integrity and mechanical properties of extracellular matrix (ECM) in various tissues. Its function is pivotal in processes such as tissue remodeling, wound healing, and fibrosis. Dysregulation of LOX activity has been implicated in various pathological conditions, including cancer progression, cardiovascular diseases, and fibrotic disorders. Consequently, LOX has emerged as a potential therapeutic target. Research endeavors have focused on the molecular mechanisms regulating LOX expression and activity, as well as its role in disease progression. Recombinant LOX proteins have been developed to facilitate studies on enzyme kinetics, substrate specificity, and interactions with ECM components. Moreover, these recombinant proteins are utilized in the development of biomaterials and tissue engineering applications, aiming to harness LOX's ability to enhance ECM stability and promote tissue regeneration. Overall, the investigation of LOX and its recombinant forms provides valuable insights into its biological functions and therapeutic potentials in addressing various health challenges.











