Analytical Data
-
Gene name
GPBAR1
- Application
-
Alternative Names
(G-protein coupled receptor GPCR19)(hGPCR19)(Membrane-type receptor for bile acids)(M-BAR)(hBG37)(BG37)
-
Species
Human
-
Source
E. coli
-
Tag
C - His Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDU6
-
Expression Region
283-330aa
-
AA Sequence
GDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN
-
Molecular Weight
21.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
GPBAR1, also known as the G-protein-coupled bile acid receptor 1, has garnered significant attention in recent years due to its crucial role in regulating bile acid homeostasis, metabolism, and inflammatory responses. As a member of the G-protein-coupled receptor (GPCR) family, GPBAR1 is primarily expressed in the enteroendocrine cells of the intestine and in various organs, including the liver and adipose tissue. Its activation by bile acids triggers several signaling pathways, influencing metabolic processes and potentially offering therapeutic avenues for conditions such as obesity, type 2 diabetes, and non-alcoholic fatty liver disease. The research on GPBAR1 recombinant protein has focused on elucidating its structure-function relationship, mechanisms of action, and potential as a drug target. Advances in recombinant protein technology have enabled the production and functional characterization of GPBAR1, facilitating the exploration of its therapeutic potential. Studies have shown that GPBAR1 activation can enhance insulin sensitivity, promote energy expenditure, and exert anti-inflammatory effects, making it a compelling candidate for drug development. Furthermore, understanding the intricate signaling pathways associated with GPBAR1 could provide insights into broader metabolic regulatory networks and their implications in metabolic syndromes. As research continues to unfold, GPBAR1 represents a promising avenue for developing innovative treatments that address metabolic disorders and improve overall health outcomes.
