Cat: IPD-X32959

Recombinant Human EphA3 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EphA3

  • 简介

    The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Human (HEK293, His) is the recombinant human-derived EphA3 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AW492086; Cek4; EC 2.7.10.1; EK4; End3; Eph receptor A3; EPH-like kinase 4; EPH-like tyrosine kinase 1; EPHA3; ETK; ETK1; HEK 4; HEK; HEK4; Tyro 4

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29320-1

  • Expression Region

    E21-Q541

  • AA Sequence

    ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    67.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EphA3 is a member of the Eph receptor family, which are the largest subfamily of receptor tyrosine kinases. These receptors play critical roles in regulating cell-cell interactions, as well as mediating cell adhesion, migration, and tissue organization during embryonic development and in adult tissues. Given their involvement in various physiological processes, EphA3 has garnered attention for its potential implications in cancer biology, particularly in tumorigenesis and metastasis. Overexpression of EphA3 has been associated with several types of cancers, making it a promising biomarker and therapeutic target. Researchers are focusing on the development of EphA3 recombinant proteins to facilitate the study of its structural and functional properties, alongside its interaction with ligands known as ephrins. By investigating the signaling pathways activated by EphA3, as well as its role in tumor progression, scientists aim to uncover novel insights into cancer treatment. The engineering of EphA3 recombinant proteins allows for detailed studies, helping to elucidate the receptor's mechanisms and potential as a target for drug development, providing a pathway towards innovative cancer therapies and advancing understanding of receptor-mediated signaling in pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US