Analytical Data
-
Gene name
CHMP1B
- Application
-
Alternative Names
CHMP1B; C18orf2Charged multivesicular body protein 1b; CHMP1.5; Chromatin-modifying protein 1b; CHMP1b; Vacuolar protein sorting-associated protein 46-2; Vps46-2; hVps46-2
-
Species
Human
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7LBR1
-
Expression Region
M1-199V
-
AA Sequence
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHMP1B (Charged Multivesicular Body Protein 1B) is a member of the CHMP family that plays a crucial role in the endosomal sorting complex required for transport (ESCRT) machinery, which is essential for the biogenesis of multivesicular bodies (MVBs) and the process of cytokinesis. Research into CHMP1B has gained prominence due to its involvement in various cellular processes and its potential implications in neurodegenerative diseases, particularly those characterized by extracellular protein aggregation. Mutations and dysregulation of CHMP1B have been linked to altered cellular homeostasis and impaired autophagic and endocytic pathways, leading to the accumulation of toxic protein aggregates. Recombinant CHMP1B proteins are increasingly being studied for their structural and functional properties, with the aim of understanding their role in cellular dynamics and disease mechanisms. Furthermore, the development of CHMP1B as a target for therapeutic intervention is being explored, especially in the context of mitigating the effects of protein misfolding disorders. The study of CHMP1B recombinant proteins thus represents a promising avenue for uncovering new insights into cellular pathways and offers potential for the development of novel therapeutic strategies.











