Cat: IPD-X24997

Recombinant Human SRSF1 Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SRSF1

  • 简介

    The SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosome components and forms a bridge between 5'- and 3'-splice site binding elements. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Human SRSF1, at 2 μg/mL (100μL/well) can bind Anti-SRSF1 antibody. The ED50 for this effect is ≤6.802 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Human SRSF1, at 2 μg/mL (100 μL/well) can bind Anti-SRSF1 antibody. The ED50 for this effect is 6.802 ng/mL.

  • Alternative Names

    Alternative-splicing factor 1; ASF-1Splicing factor; arginine/serine-rich 1pre-mRNA-splicing factor SF2; P33 subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-SUMO;N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q07955-1

  • Expression Region

    S2-T248

  • AA Sequence

    SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SRSF1, or Serine/Arginine-Rich Splicing Factor 1, is a crucial member of the serine/arginine-rich protein family, playing a vital role in pre-mRNA splicing and gene regulation. Research highlights that SRSF1 influences alternative splicing events, thereby impacting diverse processes such as cell proliferation, differentiation, and apoptosis. Elevated levels of SRSF1 have been linked to several types of cancers, including breast cancer and leukemia, underscoring its potential as a biomarker and therapeutic target. Furthermore, SRSF1 interacts with various splicing factors and RNA-binding proteins, contributing to a complex regulatory network that fine-tunes gene expression. Its role in splicing regulation extends to the modulation of cancer-related isoforms, making it a critical focus of investigation in understanding tumorigenesis. Recent studies utilizing recombinant SRSF1 proteins have facilitated the exploration of its function and interactions at the molecular level, paving the way for innovative strategies in cancer treatment and personalized medicine. The ongoing research seeks to elucidate the precise mechanisms by which SRSF1 exerts its effects on splicing and gene expression, emphasizing its significance in both basic biology and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US