Analytical Data
-
Gene name
SLC22A23
- Application
-
Alternative Names
Solute carrier family 22 member 23; C6orf85
-
Species
Human
-
Source
HEK293
-
Tag
N-8*His;C-Flag;N-MBP
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1A5C7-1
-
Expression Region
A2-M686
-
AA Sequence
AIDRRREAAGGGPGRQPAPAEENGSLPPGDAAASAPLGGRAGPGGGAEIQPLPPLHPGGGPHPSCCSAAAAPSLLLLDYDGSVLPFLGGLGGGYQKTLVLLTWIPALFIGFSQFSDSFLLDQPNFWCRGAGKGTELAGVTTTGRGGDMGNWTSLPTTPFATAPWEAAGNRSNSSGADGGDTPPLPSPPDKGDNASNCDCRAWDYGIRAGLVQNVVSKWDLVCDNAWKVHIAKFSLLVGLIFGYLITGCIADWVGRRPVLLFSIIFILIFGLTVALSVNVTMFSTLRFFEGFCLAGIILTLYALRIELCPPGKRFMITMVASFVAMAGQFLMPGLAALCRDWQVLQALIICPFLLMLLYWSIFPESLRWLMATQQFESAKRLILHFTQKNRMNPEGDIKGVIPELEKELSRRPKKVCIVKVVGTRNLWKNIVVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCLAMCVVVRFLGRRGGLLLFMILTALASLLQLGLLNLIGKYSQHPDSGMSDSVKDKFSIAFSIVGMFASHAVGSLSVFFCAEITPTVIRCGGLGLVLASAGFGMLTAPIIELHNQKGYFLHHIIFACCTLICIICILLLPESRDQNLPENISNGEHYTRQPLLPHKKGEQPLLLTNAELKDYSGLHDAAAAGDTLPEGATANGMKAM
-
Protein Length
Full Length of Isoform-1
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC22A23, a member of the solute carrier family, primarily functions as a transport protein involved in the uptake and efflux of various compounds across cellular membranes. Research on SLC22A23 has gained traction due to its potential roles in drug metabolism and pharmacokinetics, as well as its implications in various diseases, including cancer and metabolic disorders. The study of SLC22A23 reconstituted proteins is crucial for understanding its transport mechanisms and substrate specificity, which can aid in the identification of novel therapeutic targets. Through techniques such as recombinant protein expression, purification, and functional assays, researchers aim to elucidate the functional characteristics of SLC22A23, assess its interaction with different ligands, and explore its regulatory pathways. These investigations not only enhance our comprehension of this protein's biological significance but also pave the way for potential clinical applications, including personalized medicine strategies that leverage individual genetic variations in transporter expression and function. As the landscape of pharmacogenomics evolves, the evaluation of transporters like SLC22A23 will be instrumental in optimizing drug efficacy and minimizing adverse effects, ultimately contributing to more effective and tailored therapeutic interventions.











