Analytical Data
-
Gene name
COL4A3
-
简介
The COL4A3 protein is an important type IV collagen component that, together with laminin, proteoglycans, and nestin/nesidin, plays a role in forming the "chicken wire" network structure in the glomerular basement membrane (GBM). Key role. Its cleavage product tumstatin is derived from the NC1 domain of collagen α 3(IV) and has dual anti-angiogenic and anti-tumor cell activities. COL4A3 Protein, Human (His) is the recombinant human-derived COL4A3 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01955
-
Expression Region
G1427-K1668
-
AA Sequence
GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK
-
Protein Length
Partial
-
Molecular Weight
30.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL4A3, part of the collagen IV gene family, plays a pivotal role in the structure and function of the basement membrane, which is essential for tissue integrity and filtration functions in organs such as the kidneys and lungs. Mutations in the COL4A3 gene are associated with various disorders, including Alport syndrome, a hereditary condition characterized by progressive kidney disease, hearing loss, and ocular abnormalities. Research on recombinant COL4A3 protein focuses on understanding its molecular structure, interactions, and functional properties. This protein can be developed for use in biomimetic materials and tissue engineering applications, facilitating advancements in regenerative medicine. Investigating COL4A3's role in cellular processes and disease mechanisms enhances our understanding of collagen-related pathologies, paving the way for potential therapeutic interventions. By producing and studying recombinant COL4A3, researchers aim to elucidate its contributions to human health and disease, providing insights that may lead to innovative treatments for collagen-related disorders.











