Analytical Data
-
Gene name
MMP-14
- Application
-
Species
Human
-
Source
HEK293
-
Tag
C-8*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50281
-
Expression Region
Y112-A541
-
AA Sequence
YAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAA
-
Protein Length
Extracellular Domain
-
Molecular Weight
38-48 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MMP-14, also known as membrane-type matrix metalloproteinase-1 (MT1-MMP), is a pivotal enzyme in the matrix metalloproteinase (MMP) family, which plays a critical role in extracellular matrix (ECM) remodeling. It is primarily involved in the degradation of various ECM components and is crucial for processes such as cell migration, tissue repair, and wound healing. Given its involvement in these biological processes, MMP-14 has gained attention in cancer research, particularly in tumor invasion and metastasis, as it facilitates cancer cell movement through the ECM. Moreover, dysregulation of MMP-14 has been associated with various pathological conditions, including rheumatoid arthritis, cardiovascular diseases, and fibrosis. As a result, MMP-14 is considered a potential therapeutic target for treating these disorders. The production of recombinant MMP-14 proteins has enabled researchers to study the enzyme's structure and function in detail, facilitating the development of inhibitors and advancing our understanding of its role in disease contexts. Overall, research on MMP-14 is significant for both basic science and translational medicine, potentially leading to innovative therapeutic strategies for ECM-related diseases.











