Analytical Data
-
Gene name
NANS
-
简介
NANS Protein is an enzyme that functions in the biosynthetic pathways of sialic acids. NANS protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively. NANS Protein, Human (His) is the recombinant human-derived NANS protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Sialic Acid Synthase; N-Acetylneuraminate Synthase; N-Acetylneuraminate-9-Phosphate Synthase; N-Acetylneuraminic Acid Phosphate Synthase; N-Acetylneuraminic Acid Synthase; NANS; SAS
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH19315.1
-
Expression Region
M1-S359
-
AA Sequence
MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS
-
Protein Length
Full Length
-
Molecular Weight
42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NANS (N-Acetylneuraminate synthase) is an enzyme that plays a crucial role in the biosynthesis of sialic acids, which are key components found on the surfaces of cells and in various biological fluids. Sialic acids are involved in numerous biological processes, including cell signaling, immune response, and pathogen recognition. The study of NANS and its recombinant protein has garnered significant attention due to the enzyme's potential applications in biotechnology and medicine. Understanding the structure and function of NANS may lead to advancements in therapeutic strategies for diseases linked to sialic acid metabolism, such as cancer, neurodegenerative disorders, and viral infections. Recombinant NANS protein can also be utilized in the development of glycoengineering techniques, allowing for the modification of glycoproteins and the creation of novel biomolecules with enhanced properties. By elucidating the mechanisms of NANS and producing its recombinant form, researchers aim to pave the way for innovative applications in drug development and the production of therapeutic agents, ultimately contributing to improved health outcomes.
