Cat: IPD-X24893

Recombinant Human Frataxin/FXN Protein,His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Frataxin/FXN

  • 简介

    Frataxin/FXN protein activates the core iron-sulfur cluster assembly complex and accelerates sulfur transfer for [2Fe-2S] cluster assembly. It plays a key role in the de novo synthesis of clusters, delivering persulfide to the ISCU. Frataxin/FXN Protein, Human (His, Myc) is the recombinant human-derived Frataxin/FXN protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CyaY; FRDA; X25

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-Myc;N-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16595-1

  • Expression Region

    M1-A210

  • AA Sequence

    MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Frataxin (FXN) is a mitochondrial protein critical for iron-sulfur cluster synthesis and overall mitochondrial function. Its deficiency is primarily associated with Friedreich's ataxia, a genetic disorder characterized by progressive neurological and muscular degeneration. The FXN gene, located on chromosome 9, encodes a 210-amino acid protein that plays a crucial role in cellular iron metabolism and protection against oxidative stress. Research has shown that mutations in the FXN gene lead to reduced frataxin levels, resulting in iron accumulation, mitochondrial dysfunction, and apoptosis in neuronal cells. The need for therapeutic interventions has spurred interest in the recombinant production of frataxin. Recombinant FXN can be utilized to study its biological functions, understand the molecular mechanisms underlying Friedreich's ataxia, and explore potential treatments. Such studies often involve evaluating the effects of frataxin on mitochondrial dynamics, cellular iron homeostasis, and overall cellular health. Additionally, the development of recombinant FXN as a therapeutic candidate could pave the way for innovative treatment strategies, including gene therapy, small molecules that enhance FXN expression, or protein replacement therapies. By deepening our understanding of the role of FXN in the cell and its implications in disease, researchers aim to uncover novel approaches to mitigate the devastating effects of Friedreich's ataxia and improve the quality of life for affected individuals.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US