Cat: IPD-X24778

Recombinant Human VHL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VHL

  • 简介

    VHL protein is an important component of the von Hippel-Lindau ubiquitination complex and plays a key role in ubiquitination and proteasomal degradation. As a target recruitment subunit in the E3 ubiquitin ligase complex, VHL specifically recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions and regulates cellular responses to oxygen levels. VHL Protein, Human (His) is the recombinant human-derived VHL protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    von Hippel-Lindau disease tumor suppressor; Protein G7; pVHL; VHL

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P40337

  • Expression Region

    M1-D213

  • AA Sequence

    MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

  • Protein Length

    Full Length

  • Molecular Weight

    34 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VHL (Von Hippel-Lindau) disease is a hereditary cancer syndrome characterized by the development of various tumors, particularly in the kidneys and central nervous system, due to mutations in the VHL gene. This gene encodes a protein that plays a crucial role in the regulation of hypoxia-inducible factors (HIFs), which are essential for cellular responses to low oxygen levels. Under normoxic conditions, the VHL protein facilitates the ubiquitination and subsequent degradation of HIFs, thereby preventing the activation of genes that promote angiogenesis and cell proliferation. However, mutations in the VHL gene lead to the stabilization of HIFs, resulting in uncontrolled cell growth and increased tumor risk. Research into the recombinant VHL protein has gained momentum as scientists seek to understand its structural and functional properties. This protein holds potential not only as a biomarker for VHL disease but also as a therapeutic target for strategies aimed at modulating HIF activity in various cancers. Studying VHL protein interactions and its role in the ubiquitin-proteasome pathway is vital for uncovering the underlying mechanisms of VHL-associated malignancies and developing novel intervention strategies. Advances in recombinant protein technology enable the production of functional VHL protein, allowing for in-depth biochemical analyses and the exploration of VHL’s interactions with other cellular components. Overall, the investigation of recombinant VHL protein is integral to elucidating the pathophysiology of VHL disease, enhancing our understanding of tumor biology, and paving the way for innovative therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US