Analytical Data
-
Gene name
GSTM2
-
简介
GSTM2 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles and actively participates in synthesizing hepoxilin regioisomers, as documented. This underscores GSTM2's multifunctional nature, emphasizing its role in detoxification and forming unique molecular species, contributing to the broader cellular response to various electrophilic compounds. GSTM2 Protein, Human (N-His) is the recombinant human-derived GSTM2, expressed by E. coli, with N-6*His labeled tag. The total length of GSTM2 Protein, Human (N-His) is 218 a.a..
- Application
-
Alternative Names
Glutathione S-transferase Mu 2; GST class-mu 2; GSTM2-2; GST4
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P28161-1
-
Expression Region
M1-K218
-
AA Sequence
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GSTM2, or Glutathione S-transferase mu 2, is an important enzyme that plays a critical role in detoxification processes by catalyzing the conjugation of glutathione to various endogenous and exogenous compounds, thereby facilitating their excretion. The study of GSTM2 is significant due to its involvement in the metabolism of several carcinogens, drugs, and environmental pollutants, which has implications for cancer research and therapeutic strategies. Additionally, GSTM2 is associated with oxidative stress response and inflammatory processes, making it a focus of investigation in various diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. The exploration of GSTM2, particularly through recombinant protein technologies, allows researchers to produce large quantities of functional enzyme for biochemical assays and structural studies. These studies can elucidate the enzyme's mechanism of action, identify potential inhibitors, and further understand its role in physiological and pathological contexts. Understanding GSTM2's structure and function could unveil novel therapeutic targets and biomarkers, contributing to advancements in personalized medicine and environmental health. Overall, GSTM2 is a prime candidate for further research due to its multifaceted roles in metabolism, detoxification, and disease pathology.











