Cat: IPD-X11675

Recombinant Human GFRA3/GDNFR-alpha-3 Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GFRA3/GDNFR-alpha-3

  • 简介

    GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.

  • Alternative Names

    GDNF family receptor alpha-3; GFR-alpha-3; GFRA3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    O60609-1

  • Expression Region

    D32-W382

  • AA Sequence

    DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRPQPW

  • Protein Length

    Partial

  • Molecular Weight

    50-57 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GFRA3 (GDNF family receptor alpha 3) is a member of the GDNF (glial cell line-derived neurotrophic factor) receptor family, playing a crucial role in neuronal development and survival. It primarily interacts with GDNF, a potent neurotrophic factor, to facilitate the survival of specific neuronal populations and support the development of the peripheral nervous system. Research into GFRA3 is driven by its potential therapeutic implications, especially in neurodegenerative diseases and conditions characterized by neuronal loss. Understanding the molecular mechanisms by which GFRA3 mediates its effects can lead to novel strategies in neuroprotection and regeneration. Furthermore, GFRA3 has been implicated in various physiological processes, including kidney and reproductive system functions, making it a focal point in both neuroscience and developmental biology. The study of GFRA3/GDNF-alpha-3 recombinant proteins aims to elucidate their structure-function relationships, optimize therapeutic applications, and investigate their roles in disease contexts. By generating and characterizing GFRA3 recombinant proteins, researchers can unlock new avenues for treatment and enhance the understanding of neurotrophic signaling pathways, paving the way for innovative interventions in neuroprotection and tissue regeneration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US