Analytical Data
-
Gene name
GFRA3/GDNFR-alpha-3
-
简介
GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.
-
Alternative Names
GDNF family receptor alpha-3; GFR-alpha-3; GFRA3
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
O60609-1
-
Expression Region
D32-W382
-
AA Sequence
DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRPQPW
-
Protein Length
Partial
-
Molecular Weight
50-57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GFRA3 (GDNF family receptor alpha 3) is a member of the GDNF (glial cell line-derived neurotrophic factor) receptor family, playing a crucial role in neuronal development and survival. It primarily interacts with GDNF, a potent neurotrophic factor, to facilitate the survival of specific neuronal populations and support the development of the peripheral nervous system. Research into GFRA3 is driven by its potential therapeutic implications, especially in neurodegenerative diseases and conditions characterized by neuronal loss. Understanding the molecular mechanisms by which GFRA3 mediates its effects can lead to novel strategies in neuroprotection and regeneration. Furthermore, GFRA3 has been implicated in various physiological processes, including kidney and reproductive system functions, making it a focal point in both neuroscience and developmental biology. The study of GFRA3/GDNF-alpha-3 recombinant proteins aims to elucidate their structure-function relationships, optimize therapeutic applications, and investigate their roles in disease contexts. By generating and characterizing GFRA3 recombinant proteins, researchers can unlock new avenues for treatment and enhance the understanding of neurotrophic signaling pathways, paving the way for innovative interventions in neuroprotection and tissue regeneration.











