Analytical Data
-
Gene name
Wnt8b
-
简介
Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
- Application
-
Alternative Names
Wnt8b; Protein Wnt-8b
-
Species
Mouse
-
Source
E. coli
-
Tag
C-Myc;N-SUMO;N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9WUD6
-
Expression Region
22W-350S
-
AA Sequence
WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Wnt8b is a member of the Wnt family of signaling proteins, known for their critical roles in development, cell differentiation, and tissue homeostasis. It functions as a ligand in the Wnt/β-catenin signaling pathway, which is essential for various biological processes, including embryogenesis, stem cell maintenance, and tumorigenesis. Research has indicated that Wnt8b plays significant roles in the regulation of cell fate decisions and organ development, particularly in the context of vertebrate embryology. Its involvement in various diseases, including cancer, makes it an important target for therapeutic interventions. Understanding the molecular mechanisms of Wnt8b's action can shed light on its potential applications in regenerative medicine and cancer therapy. Recent studies have focused on the production and characterization of recombinant Wnt8b protein to facilitate high-throughput assays and structural analyses. This research aims to elucidate the functional roles of Wnt8b in cellular contexts and its interactions with other pathway components. The generation of Wnt8b recombinant proteins has paved the way for investigating the structure-function relationship and exploring pharmacological agents that can modulate its activity, making it a focal point in developmental biology and therapeutic research.
