Analytical Data
-
Gene name
PPP1CB
- Application
-
Alternative Names
PP-1B; PPP1CB; PPP1CD; MGC3672
-
Species
Human
-
Source
Baculovirus
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P62140
-
Expression Region
M1-R327
-
AA Sequence
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
-
Protein Length
Full Length
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PPP1CB, or Protein Phosphatase 1 Catalytic Subunit Beta, is a pivotal enzyme in the regulation of various cellular processes, including cell division, metabolism, and signal transduction. This serine/threonine phosphatase is part of a larger family of protein phosphatases that play critical roles in dephosphorylating proteins, thereby modulating their activity and function. The study of PPP1CB has garnered significant interest due to its involvement in several pathological conditions, such as cancer, cardiovascular diseases, and neurodegenerative disorders. Understanding the structure, function, and regulatory mechanisms of PPP1CB can provide insights into its role in health and disease. Recent advances in recombinant protein technology have enabled the production of PPP1CB in heterologous systems, allowing researchers to study its biochemical properties and interactions in detail. Through the characterization of its enzymatic activity and the identification of specific inhibitors, the research focuses on elucidating the therapeutic potential of targeting PPP1CB for disease treatment. Additionally, exploring its interactions with various regulatory proteins and signaling pathways could reveal novel approaches to modulate its activity for clinical applications. Overall, the investigation of PPP1CB and its recombinant forms represents a promising area of research with implications for drug development and the understanding of cellular signaling networks.











