Cat: IPD-X32616

Recombinant Human PPP1CB Protein (Baculovirus),GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PPP1CB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PP-1B; PPP1CB; PPP1CD; MGC3672

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    N-GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P62140

  • Expression Region

    M1-R327

  • AA Sequence

    MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

  • Protein Length

    Full Length

  • Molecular Weight

    60 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PPP1CB, or Protein Phosphatase 1 Catalytic Subunit Beta, is a pivotal enzyme in the regulation of various cellular processes, including cell division, metabolism, and signal transduction. This serine/threonine phosphatase is part of a larger family of protein phosphatases that play critical roles in dephosphorylating proteins, thereby modulating their activity and function. The study of PPP1CB has garnered significant interest due to its involvement in several pathological conditions, such as cancer, cardiovascular diseases, and neurodegenerative disorders. Understanding the structure, function, and regulatory mechanisms of PPP1CB can provide insights into its role in health and disease. Recent advances in recombinant protein technology have enabled the production of PPP1CB in heterologous systems, allowing researchers to study its biochemical properties and interactions in detail. Through the characterization of its enzymatic activity and the identification of specific inhibitors, the research focuses on elucidating the therapeutic potential of targeting PPP1CB for disease treatment. Additionally, exploring its interactions with various regulatory proteins and signaling pathways could reveal novel approaches to modulate its activity for clinical applications. Overall, the investigation of PPP1CB and its recombinant forms represents a promising area of research with implications for drug development and the understanding of cellular signaling networks.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US