Cat: IPD-X11671

Recombinant Mouse GFRA2/GDNFR-alpha-2 Protein(HEK293), C-10*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GFRA2/GDNFR-alpha-2

  • 简介

    GFRA2/GDNFR-α-2 protein acts as a receptor for neurotrophic factors and promotes NRTN-induced autophosphorylation and RET receptor activation. It also mediates GDNF signaling through the RET tyrosine kinase receptor. GFRA2/GDNFR-alpha-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Neurturin at 1 μg/mL binds Recombinant Mouse GFR alpha-2/GDNF R alpha-2. The ED50 for this effect is 3.307 nM. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Neurturin at 1 μg/mL binds Recombinant Mouse GFR alpha-2/GDNF R alpha-2 .The ED50 for this effect is 3.307 nM.

  • Alternative Names

    GDNF Family Receptor Alpha-2; GFR-Alpha-2; GDNFR-Beta; NRTNR-Alpha; GDNFRB; RETL2; TRNR2

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    O08842-1

  • Expression Region

    S22-S441

  • AA Sequence

    SPSSPQGSELHGWRPQVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYRTITSCPADNYQACLGSYAGMIGFDMTPNYVDSNPTGIVVSPWCNCRGSGNMEEECEKFLKDFTENPCLRNAIQAFGNGTDVNMSPKGPTFSATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSIQEQGLKANNSKELSMCFTELTTNISPGSKKVIKLYS

  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Molecular Weight

    70-80 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GFRA2, or Glial Cell Line-Derived Neurotrophic Factor Receptor Alpha-2, is a member of the GDNF (glial cell line-derived neurotrophic factor) receptor family, which plays a crucial role in the development and maintenance of the nervous system. GFRA2 is known to modulate neuronal survival, differentiation, and the formation of neural circuits through its interaction with GDNF family ligands. The study of GFRA2, particularly its recombinant protein, is vital for understanding its biological functions and potential therapeutic applications in neurodegenerative diseases and injury repair. Research has indicated that GFRA2 is involved in various biological processes, including neurogenesis and the response to nerve injury, making it a promising target for developing neuroprotective strategies. Additionally, GFRA2 has been implicated in the regulation of specific signaling pathways that contribute to cellular resilience and plasticity in the nervous system. The production and characterization of recombinant GFRA2 protein allow for in-depth analyses of its structure and function, facilitating the exploration of its therapeutic potential. Understanding the mechanistic pathways mediated by GFRA2 could lead to advancements in treatments for conditions such as Parkinson's disease, multiple sclerosis, and spinal cord injuries, highlighting the importance of GFRA2 in both fundamental neurobiology and translational medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US