Analytical Data
-
Gene name
GFRA2/GDNFR-alpha-2
-
简介
GFRA2/GDNFR-α-2 protein acts as a receptor for neurotrophic factors and promotes NRTN-induced autophosphorylation and RET receptor activation. It also mediates GDNF signaling through the RET tyrosine kinase receptor. GFRA2/GDNFR-alpha-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GFRA2/GDNFR-alpha-2 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Neurturin at 1 μg/mL binds Recombinant Mouse GFR alpha-2/GDNF R alpha-2. The ED50 for this effect is 3.307 nM. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Neurturin at 1 μg/mL binds Recombinant Mouse GFR alpha-2/GDNF R alpha-2 .The ED50 for this effect is 3.307 nM.
-
Alternative Names
GDNF Family Receptor Alpha-2; GFR-Alpha-2; GDNFR-Beta; NRTNR-Alpha; GDNFRB; RETL2; TRNR2
-
Species
Mouse
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
O08842-1
-
Expression Region
S22-S441
-
AA Sequence
SPSSPQGSELHGWRPQVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYRTITSCPADNYQACLGSYAGMIGFDMTPNYVDSNPTGIVVSPWCNCRGSGNMEEECEKFLKDFTENPCLRNAIQAFGNGTDVNMSPKGPTFSATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSIQEQGLKANNSKELSMCFTELTTNISPGSKKVIKLYS
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
70-80 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GFRA2, or Glial Cell Line-Derived Neurotrophic Factor Receptor Alpha-2, is a member of the GDNF (glial cell line-derived neurotrophic factor) receptor family, which plays a crucial role in the development and maintenance of the nervous system. GFRA2 is known to modulate neuronal survival, differentiation, and the formation of neural circuits through its interaction with GDNF family ligands. The study of GFRA2, particularly its recombinant protein, is vital for understanding its biological functions and potential therapeutic applications in neurodegenerative diseases and injury repair. Research has indicated that GFRA2 is involved in various biological processes, including neurogenesis and the response to nerve injury, making it a promising target for developing neuroprotective strategies. Additionally, GFRA2 has been implicated in the regulation of specific signaling pathways that contribute to cellular resilience and plasticity in the nervous system. The production and characterization of recombinant GFRA2 protein allow for in-depth analyses of its structure and function, facilitating the exploration of its therapeutic potential. Understanding the mechanistic pathways mediated by GFRA2 could lead to advancements in treatments for conditions such as Parkinson's disease, multiple sclerosis, and spinal cord injuries, highlighting the importance of GFRA2 in both fundamental neurobiology and translational medicine.











