Cat: IPD-X24680

Recombinant Human NFKB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NFKB1

  • 简介

    The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DNA-binding factor KBF1; EBP-1; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P19838-2

  • Expression Region

    M1-G434

  • AA Sequence

    MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

  • Protein Length

    Full Length of NFKB1

  • Molecular Weight

    45-55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NFKB1 (Nuclear Factor Kappa B Subunit 1) is a crucial transcription factor involved in various cellular processes, including immune response, inflammation, and cell survival. Dysregulation of NFKB1 has been implicated in multiple diseases, such as cancer, autoimmune disorders, and inflammatory diseases. Research on NFKB1 recombinant protein aims to better understand its structure, function, and regulatory mechanisms. By producing NFKB1 in a recombinant form, scientists can investigate its interactions with other proteins, determine its role in signaling pathways, and explore its potential as a therapeutic target. This involves the use of molecular cloning techniques to generate expression vectors that allow for the efficient production of the protein in host cells, such as bacteria, yeast, or mammalian cells. Investigating NFKB1's behavior under various physiological conditions can reveal insights into its role in pathological states. Additionally, recombinant NFKB1 can be used in drug discovery and development, facilitating the screening of small molecules that modulate its activity. Overall, the study of NFKB1 recombinant protein is pivotal for understanding its biological significance and for developing novel therapeutic strategies targeting NFKB1-related pathways.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US