Analytical Data
-
Gene name
NFKB1
-
简介
The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
DNA-binding factor KBF1; EBP-1; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19838-2
-
Expression Region
M1-G434
-
AA Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG
-
Protein Length
Full Length of NFKB1
-
Molecular Weight
45-55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NFKB1 (Nuclear Factor Kappa B Subunit 1) is a crucial transcription factor involved in various cellular processes, including immune response, inflammation, and cell survival. Dysregulation of NFKB1 has been implicated in multiple diseases, such as cancer, autoimmune disorders, and inflammatory diseases. Research on NFKB1 recombinant protein aims to better understand its structure, function, and regulatory mechanisms. By producing NFKB1 in a recombinant form, scientists can investigate its interactions with other proteins, determine its role in signaling pathways, and explore its potential as a therapeutic target. This involves the use of molecular cloning techniques to generate expression vectors that allow for the efficient production of the protein in host cells, such as bacteria, yeast, or mammalian cells. Investigating NFKB1's behavior under various physiological conditions can reveal insights into its role in pathological states. Additionally, recombinant NFKB1 can be used in drug discovery and development, facilitating the screening of small molecules that modulate its activity. Overall, the study of NFKB1 recombinant protein is pivotal for understanding its biological significance and for developing novel therapeutic strategies targeting NFKB1-related pathways.











