Analytical Data
-
Gene name
STC1/Stanniocalcin-1
-
简介
STC1/Stanniocalcin-1 Proteinas, a homodimer, crucially stimulates renal phosphate reabsorption, safeguarding against hypercalcemia. Disulfide linkages contribute to its structural integrity. Its role in renal processes underscores significance in regulating phosphate levels, emphasizing a key role in maintaining mineral homeostasis. STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is the recombinant human-derived STC1/Stanniocalcin-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
1.Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×105 U/mg. 2.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 30.85 ng/mL in the presence of 10 ng/mL of Recombinant Mouse Wnt-3a. corresponding to a specific activity is 3.241×104 units/mg. Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×105 U/mg.
-
Alternative Names
Stanniocalcin 1; stanniocalcin-1; STC1; STC-1; STCSTC-1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P52823-1
-
Expression Region
T18-A247
-
AA Sequence
THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
30-40 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Stanniocalcin-1 (STC1) is a glycoprotein originally identified in fish, playing a crucial role in calcium and phosphate homeostasis. In lower vertebrates, STC1 is known to regulate mineral metabolism, particularly in response to environmental changes. Recent studies have shown that STC1 also has significant implications in human physiology, influencing various cellular processes such as proliferation, differentiation, and apoptosis. Its dysregulation has been linked to several diseases, including cancer and bone disorders, making it a target of interest in biomedical research. The recombinant version of STC1, produced through recombinant DNA technology, allows for extensive in vitro studies, enabling researchers to investigate its structure-function relationships and therapeutic potential. Furthermore, understanding STC1's signaling pathways could provide insights into its role in cellular homeostasis and its mechanisms in disease progression. As such, the study of STC1 and its recombinant forms is essential for advancing knowledge in endocrinology, oncology, and tissue regeneration, establishing a foundation for developing novel therapeutic strategies.











