Cat: IPD-X32571

Recombinant Staphylococcus aureus Peptide deformylase Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Peptide deformylase

  • 简介

    Peptide deformylase, a crucial enzyme in protein biosynthesis, catalyzes the removal of the formyl group from the N-terminal methionine of newly synthesized proteins. Displaying broad specificity at positions beyond the N-terminal L-methionine, the enzyme ensures proper maturation and functionality of proteins, emphasizing its essential contribution to the intricate process of protein synthesis and modification. Peptide deformylase Protein, S. aureus (His, SUMO) is the recombinant staphylococcus aureus-derived Peptide deformylase protein, expressed by E. coli, with SUMO and N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    def; def1; pdf1Peptide deformylase; PDF; EC 3.5.1.88; Polypeptide deformylase

  • Species

    Staphylococcus aureus

  • Source

    E. coli

  • Tag

    SUMO;N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P68826

  • Expression Region

    M1-V183

  • AA Sequence

    MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

  • Protein Length

    Full Length

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Peptide deformylase (PDF) is an essential bacterial enzyme that plays a crucial role in the co-translational processing of newly synthesized proteins by removing the N-formyl group from the N-terminus of formylmethionyl peptides. This enzymatic activity is vital for the maturation of proteins and is unique to prokaryotes, making PDF a potential target for antibiotic drug development. The increasing prevalence of antibiotic-resistant bacteria has intensified the search for novel therapeutic agents, with PDF emerging as a promising candidate due to its distinct mechanism of action. Research on recombinant PDF has gained momentum, focusing on its structure, function, and interaction with potential inhibitors. By producing recombinant PDF in suitable expression systems, researchers are able to study its catalytic properties in detail and assess the impact of various small molecules as inhibitors. This work not only deepens our understanding of bacterial protein synthesis but could also aid in the design of targeted inhibitors that circumvent existing resistance mechanisms. Overall, the exploration of recombinant peptide deformylase holds significant implications for microbiology and pharmaceutical development, offering new avenues for combating antibiotic resistance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US