Analytical Data
-
Gene name
C1QTNF3/CTRP3
-
简介
C1QTNF3/CTRP3 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. C1QTNF3/CTRP3 Protein by participating in the TGF-尾1/Smad, Sirtuin 1/NF-魏B, AMPK and Signaling pathways such as LAMP1/JIP2/JNK have extensive effects on tumor, inflammation, metabolism, and insulin sensitization. C1QTNF3/CTRP3 Protein, Human (His) is the recombinant human-derived C1QTNF3/CTRP3 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Biological Activity
Immobilized Human CTRP3 at 4 μg/mL (100 μL/well) can bind Human CD36 Protein. The ED50 for this effect is 4.475 μg/mL. Immobilized Human CTRP3 at 4 μg/mL (100 μL/well) can bind Human CD36 Protein. The ED50 for this effect is 4.475 μg/mL.
-
Alternative Names
C1ATNF3; C1q and tumor necrosis factor related protein 3 Complement C1q tumor necrosis factor related protein 3 ; Complement C1q tumor necrosis factor-related protein 3; Corcs; CORS 26; Cors; CORS26; CTRP3; FLJ37576
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9BXJ4-1
-
Expression Region
Q23-K246
-
AA Sequence
QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
25-28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1QTNF3, also known as C1q/TNF-related protein 3 (CTRP3), is a member of the CTRP family that plays a crucial role in various physiological and pathological processes, including metabolism, inflammation, and cardiovascular health. The protein exhibits structural similarities to adiponectin and is involved in regulating glucose metabolism, insulin sensitivity, and lipid homeostasis, making it particularly relevant in the context of obesity and type 2 diabetes. Recent studies suggest that CTRP3 has anti-inflammatory properties and may contribute to the protection against vascular injury and metabolic syndrome. Given its potential therapeutic implications, research focusing on the recombinant production of C1QTNF3/CTRP3 seeks to explore its physiological roles further and evaluate its efficacy as a biomarker or therapeutic target for metabolic diseases. Investigating the biological functions and mechanisms of action of this protein not only enhances our understanding of metabolic regulation but also paves the way for developing innovative treatment strategies for obesity-related disorders. As the demand for effective therapies increases, the recombinant protein's characterization and analysis can facilitate further clinical applications and improve disease management outcomes for patients suffering from metabolic syndromes.
