Analytical Data
-
Gene name
MORF4L2
-
简介
The MORF4L2 protein is an important component of the NuA4 histone acetyltransferase complex and promotes transcriptional activation by acetylating histones H4 and H2A. This modification alters nucleosome-DNA interactions and promotes interactions with other transcription-positive proteins. MORF4L2 Protein, Human (His) is the recombinant human-derived MORF4L2 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Mortality Factor 4-Like Protein 2; MORF-Related Gene X Protein; Protein MSL3-2; Transcription Factor-Like Protein MRGX; MORF4L2; KIAA0026; MRGX
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15014
-
Expression Region
M1-L288
-
AA Sequence
MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
-
Protein Length
Full Length
-
Molecular Weight
33-36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MORF4L2, a member of the MRG (MORF4-related gene) family, has emerged as a significant focus in cancer research due to its potential role in oncogenesis and tumor progression. This protein shares structural similarities with other MRG family members that are known to be involved in regulating gene expression and chromatin remodeling, suggesting that MORF4L2 may play a pivotal role in epigenetic modifications. Recent studies have indicated that MORF4L2 is overexpressed in various types of cancers, leading to speculation about its contribution to malignant transformation and tumor cell proliferation. The protein's interactions with chromatin-modifying complexes and transcription factors highlight its potential as a therapeutic target. Furthermore, understanding the molecular mechanisms by which MORF4L2 influences gene expression could reveal novel insights into cancer biology and progression. As researchers delve deeper into the functional characterization of recombinant MORF4L2, its interactions with other cellular pathways are under investigation, aiming to elucidate its precise role in tumorigenesis. This research could pave the way for the development of targeted therapies against cancers where MORF4L2 is implicated, making it a promising candidate for further exploration in the realm of cancer treatment and management.
