Analytical Data
-
Gene name
NT5C2
- Application
-
Alternative Names
NT5B; PNT5; GMP; cN-II; NT5CP; Purine 5' Nucleotidase; 5'-Nucleotidase(Purine),Cytosolic Type B; Cytosolic purine 5'-nucleotidase
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49902
-
Expression Region
1~212aa
-
AA Sequence
MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMD YTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGN LLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPET YLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKG
-
Molecular Weight
28.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
NT5C2 (5'-nucleotidase, cytosolic II) is an enzyme that plays a crucial role in nucleotide metabolism, particularly in the dephosphorylation of nucleotides to nucleosides. Its significance has been highlighted in the context of cancer research and immunology, where dysregulation of nucleotide homeostasis can lead to altered cellular proliferation and immune responses. Recent studies have shown that mutations in the NT5C2 gene are associated with resistance to certain chemotherapeutic agents, making it a potential target for therapeutic intervention. Additionally, NT5C2 has been implicated in the regulation of adenosine levels, which are known to influence tumor microenvironments and immune checkpoint pathways. The recombinant production of NT5C2 protein can facilitate in-depth studies into its enzymatic mechanisms, substrate specificity, and the role of its mutations in disease progression. This research not only aids in understanding NT5C2's biological function but also paves the way for developing novel strategies to overcome drug resistance in cancer treatments and enhance immunotherapeutic efficacy. Utilizing recombinant NT5C2, scientists can conduct biochemical assays, crystallography, and interaction studies, providing insights into the enzyme's structure-function relationship and its potential as a biomarker or therapeutic target in oncology and other fields of medicine. Consequently, the study of NT5C2 not only enriches our understanding of nucleotide metabolism but also holds promise for advancing therapeutic approaches against resistant forms of cancer and improving patient outcomes.











