Cat: IPD-X32412

Recombinant Human NT5C2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NT5C2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NT5B; PNT5; GMP; cN-II; NT5CP; Purine 5' Nucleotidase; 5'-Nucleotidase(Purine),Cytosolic Type B; Cytosolic purine 5'-nucleotidase

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49902

  • Expression Region

    1~212aa

  • AA Sequence

    MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMD YTLAVYKSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGN LLKVDAYGNLLVCAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPET YLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHYKG

  • Molecular Weight

    28.5kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NT5C2 (5'-nucleotidase, cytosolic II) is an enzyme that plays a crucial role in nucleotide metabolism, particularly in the dephosphorylation of nucleotides to nucleosides. Its significance has been highlighted in the context of cancer research and immunology, where dysregulation of nucleotide homeostasis can lead to altered cellular proliferation and immune responses. Recent studies have shown that mutations in the NT5C2 gene are associated with resistance to certain chemotherapeutic agents, making it a potential target for therapeutic intervention. Additionally, NT5C2 has been implicated in the regulation of adenosine levels, which are known to influence tumor microenvironments and immune checkpoint pathways. The recombinant production of NT5C2 protein can facilitate in-depth studies into its enzymatic mechanisms, substrate specificity, and the role of its mutations in disease progression. This research not only aids in understanding NT5C2's biological function but also paves the way for developing novel strategies to overcome drug resistance in cancer treatments and enhance immunotherapeutic efficacy. Utilizing recombinant NT5C2, scientists can conduct biochemical assays, crystallography, and interaction studies, providing insights into the enzyme's structure-function relationship and its potential as a biomarker or therapeutic target in oncology and other fields of medicine. Consequently, the study of NT5C2 not only enriches our understanding of nucleotide metabolism but also holds promise for advancing therapeutic approaches against resistant forms of cancer and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US