Analytical Data
-
Gene name
B4GALT1
- Application
-
Alternative Names
rHuB4GALT1, His; B4GALT1; Beta-1,4-GalTase 1; CDG2D
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P15291-1
-
Expression Region
G44-S398, Y285L
-
AA Sequence
GRDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPSHHHHHH
-
Protein Length
Lumenal Domain
-
Molecular Weight
50-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B4GALT1, a member of the β-1,4-galactosyltransferase family, plays a crucial role in glycosylation processes, specifically in the biosynthesis of glycoproteins and glycolipids. This enzyme catalyzes the transfer of galactose to acceptor molecules, significantly influencing cellular communication, adhesion, and immune responses. Dysregulation or mutations in the B4GALT1 gene have been linked to various pathological conditions, including certain congenital disorders and cancers, highlighting the importance of understanding its functional mechanisms. The study of recombinant B4GALT1 protein enables researchers to explore its enzymatic activity, specificity, and role in glycan formation. By employing recombinant DNA technology, scientists can produce the protein in sufficient quantities for detailed biochemical assays and structural analyses. Investigating B4GALT1 at the molecular level could provide insight into the therapeutic potential of glycosylation modulation in disease management and the development of novel biomedical applications. Consequently, ongoing research on B4GALT1 recombinant protein not only furthers fundamental knowledge in glycobiology but also paves the way for innovative strategies in drug development and personalized medicine.











