Cat: IPD-X13026

Recombinant Mouse PLGF Protein(HEK293), C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PLGF

  • 简介

    PLGF protein is an important growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration by binding to the FLT1/VEGFR-1 receptor.PLGF plays a crucial role in angiogenesis and also contributes to tumor growth, highlighting its involvement in pathological angiogenesis.PLGF Protein, Mouse (HEK293, His) is the recombinant mouse-derived PLGF protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Placenta growth factor; PlGF; Plgf; D12S1900; PGFL; PLGF; PlGF-2; SHGC-10760

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P49764

  • Expression Region

    19-158aa

  • AA Sequence

    VHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP

  • Molecular Weight

    16.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on Placentally-derived Growth Factor (PLGF) recombinant protein has garnered significant attention due to its vital role in angiogenesis and vascular biology. PLGF, a member of the vascular endothelial growth factor (VEGF) family, is primarily expressed in placental tissues and plays a critical role in the development of the placenta and embryonic growth. Its ability to regulate blood vessel formation makes it a focal point in studies related to various pathological conditions, including cancer, cardiovascular diseases, and wound healing. Recent findings suggest that PLGF influences not only endothelial cell functions but also the recruitment and activation of immune cells, positioning it as a potential therapeutic target for enhancing tissue regeneration and modulating immune responses. Researchers are exploring recombinant PLGF for clinical applications, leveraging its properties to develop novel therapies aimed at improving outcomes in diseases characterized by inadequate angiogenesis or excessive vascular growth. As the understanding of PLGF's molecular mechanisms deepens, there is a growing interest in its potential to serve as a biomarker for pregnancy-related complications and its suitability for therapeutic interventions in various diseases, highlighting the importance of continued research in this field.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US