Analytical Data
-
Gene name
MAPK1/ERK2
-
简介
ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Application
-
Alternative Names
Mitogen-activated protein kinase 1; MAPK 1; ERT1; ERK-2; p42-MAPK
-
Species
Human
-
Source
Baculovirus
-
Tag
C-8*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28482-1
-
Expression Region
M1-S360
-
AA Sequence
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The mitogen-activated protein kinase 1 (MAPK1), also known as extracellular signal-regulated kinase 2 (ERK2), is a crucial protein in the MAPK signaling pathway, which plays a vital role in regulating various cellular processes such as growth, differentiation, and survival. This pathway is activated by a range of extracellular signals, including growth factors, cytokines, and stress, leading to a cascade of phosphorylation events that ultimately influence gene expression and cell behavior. Given its central role in cell signaling, MAPK1/ERK2 is a subject of extensive research, especially in the context of cancer, where its dysregulation can contribute to tumorigenesis and cell resilience against apoptosis. The recombinant expression of MAPK1/ERK2 is essential for understanding its structure-function relationships and for developing targeted therapeutics. Researchers often utilize recombinant DNA technology to produce this protein in host systems such as bacteria or eukaryotic cells, enabling studies of its biochemical properties, interaction with downstream effectors, and potential as a therapeutic target. Understanding the dynamics of MAPK1/ERK2 is critical for elucidating the complexities of signal transduction pathways and their implications in disease progression and treatment strategies.











