Cat: IPD-X36998

Recombinant Human MAPK1/ERK2 Protein (Baculovirus),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAPK1/ERK2

  • 简介

    ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Mitogen-activated protein kinase 1; MAPK 1; ERT1; ERK-2; p42-MAPK

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    C-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28482-1

  • Expression Region

    M1-S360

  • AA Sequence

    MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The mitogen-activated protein kinase 1 (MAPK1), also known as extracellular signal-regulated kinase 2 (ERK2), is a crucial protein in the MAPK signaling pathway, which plays a vital role in regulating various cellular processes such as growth, differentiation, and survival. This pathway is activated by a range of extracellular signals, including growth factors, cytokines, and stress, leading to a cascade of phosphorylation events that ultimately influence gene expression and cell behavior. Given its central role in cell signaling, MAPK1/ERK2 is a subject of extensive research, especially in the context of cancer, where its dysregulation can contribute to tumorigenesis and cell resilience against apoptosis. The recombinant expression of MAPK1/ERK2 is essential for understanding its structure-function relationships and for developing targeted therapeutics. Researchers often utilize recombinant DNA technology to produce this protein in host systems such as bacteria or eukaryotic cells, enabling studies of its biochemical properties, interaction with downstream effectors, and potential as a therapeutic target. Understanding the dynamics of MAPK1/ERK2 is critical for elucidating the complexities of signal transduction pathways and their implications in disease progression and treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US