Analytical Data
-
Gene name
Nucleoside phosphorylase/PNP
-
简介
Nucleoside phosphorylase/PNP proteins play a vital role in cellular processes by catalyzing the phosphate breakdown of β-(deoxy)ribonucleosides, preferably 6-oxopurine nucleosides, such as inosine and guanosine. This enzymatic activity results in the formation of free purine bases and pentose 1-phosphate, highlighting the importance of this protein in regulating nucleoside degradation. Nucleoside phosphorylase/PNP Protein, Human (His) is the recombinant human-derived Nucleoside phosphorylase/PNP protein, expressed by E. coli , with C-10*His labeled tag.
- Application
-
Alternative Names
Purine nucleoside phosphorylase; PNP; Inosine phosphorylase; NP
-
Species
Human
-
Source
E. coli
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P00491
-
Expression Region
M1-S289
-
AA Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
-
Protein Length
Full Length
-
Molecular Weight
33.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nucleoside phosphorylases (NPs) are important enzymes involved in purine and pyrimidine metabolism, catalyzing the cleavage of glycosidic bonds in nucleosides to release their respective bases and ribose-1-phosphate. Among these, Purine nucleoside phosphorylase (PNP) has garnered significant attention due to its critical role in the salvage pathway of purine metabolism, which is essential for the maintenance of nucleotide pools in cells. Deficiencies or malfunctions in PNP can lead to severe immunodeficiency disorders, making it a target for therapeutic intervention. Recombinant DNA technology has enabled the production of PNP in larger quantities and with higher purity, facilitating detailed studies of its structure and function. The characterization of recombinant PNP, including kinetic parameters and substrate specificity, helps in understanding its biological roles and the consequences of genetic mutations. Moreover, the development of PNP inhibitors holds promise for potential treatments of various diseases, including cancers and viral infections. Consequently, research into the expression, purification, and functional analysis of recombinant PNP is vital for both basic science and clinical advancements.











