Cat: IPD-X36990

Recombinant Human Nucleoside phosphorylase/PNP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Nucleoside phosphorylase/PNP

  • 简介

    Nucleoside phosphorylase/PNP proteins play a vital role in cellular processes by catalyzing the phosphate breakdown of β-(deoxy)ribonucleosides, preferably 6-oxopurine nucleosides, such as inosine and guanosine. This enzymatic activity results in the formation of free purine bases and pentose 1-phosphate, highlighting the importance of this protein in regulating nucleoside degradation. Nucleoside phosphorylase/PNP Protein, Human (His) is the recombinant human-derived Nucleoside phosphorylase/PNP protein, expressed by E. coli , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Purine nucleoside phosphorylase; PNP; Inosine phosphorylase; NP

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P00491

  • Expression Region

    M1-S289

  • AA Sequence

    MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS

  • Protein Length

    Full Length

  • Molecular Weight

    33.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Nucleoside phosphorylases (NPs) are important enzymes involved in purine and pyrimidine metabolism, catalyzing the cleavage of glycosidic bonds in nucleosides to release their respective bases and ribose-1-phosphate. Among these, Purine nucleoside phosphorylase (PNP) has garnered significant attention due to its critical role in the salvage pathway of purine metabolism, which is essential for the maintenance of nucleotide pools in cells. Deficiencies or malfunctions in PNP can lead to severe immunodeficiency disorders, making it a target for therapeutic intervention. Recombinant DNA technology has enabled the production of PNP in larger quantities and with higher purity, facilitating detailed studies of its structure and function. The characterization of recombinant PNP, including kinetic parameters and substrate specificity, helps in understanding its biological roles and the consequences of genetic mutations. Moreover, the development of PNP inhibitors holds promise for potential treatments of various diseases, including cancers and viral infections. Consequently, research into the expression, purification, and functional analysis of recombinant PNP is vital for both basic science and clinical advancements.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US