Recombinant Human SIRT5 Protein，Flag

SIRT5

SIRT5 Proteins, belonging to the sirtuin family, possess a sirtuin core domain and share homology with yeast Sir2 protein. They are classified in class III of the sirtuin family and undergo alternative splicing, resulting in multiple transcript variants. Their ubiquitous expression in tissues like the heart, liver, and 25 others suggests their involvement in diverse cellular processes. SIRT5 Protein, Human (Flag) is the recombinant human-derived SIRT5 protein, expressed by E. coli , with N-Flag labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Measured by its ability to remove the succinyl group from 25 μM fluorogenic peptide substrate incubate at room temperature for 30 minutes. The specific activity is 181.22 pmol/min/μg. Western blot analysis of protein Human SIRT5 (lane 2(10ng) and lane 3(20ng)) and Human BRD4 (HY-P7846) (lane 4(10ng) and lane 5(20ng)) using Flag Tag (HRP) (HY-P80111A) Mouse mAb. Proteins were transferred to a PVDF membrane and blocked with 5% non-fat milk in TBST for 2 hour at room temperature. The primary antibody (1/1000) in 5% non-fat milk in TBST at 4°C overnight.

NAD-dependent protein deacylase sirtuin-5; SIR2-like protein 5; SIRT5; SIR2L5

Human

E. coli

N-Flag

Greater than 95% as determined by SDS-PAGE.

NP_036373.1

R2-S310

RPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

Full Length of Isoform-1

33-37 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.