Analytical Data
-
Gene name
Caspase-10/CASP10
- Application
-
Alternative Names
rHuCaspase-10, His; Caspase-10; CASP-10; Apoptotic Protease Mch-4; ICE-Like Apoptotic Protease 4; CASP10; MCH4
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92851-4
-
Expression Region
V220-R472
-
AA Sequence
VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSIHHHHHH
-
Protein Length
Partial
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Caspase-10, encoded by the CASP10 gene, is a crucial member of the cysteine-aspartic protease (caspase) family, which plays a pivotal role in the apoptosis (programmed cell death) pathway. This protein is primarily known for its role in mediating extrinsic apoptosis through the tumor necrosis factor (TNF) receptor signaling pathway and is involved in the regulation of immune responses. Mutations or dysregulation of CASP10 have been associated with various diseases, including certain cancers and autoimmune disorders. The study of recombinant Caspase-10 protein has gained significance in recent years as it provides insights into the mechanisms of cell death and survival, cell signaling pathways, and potential therapeutic applications. By producing and characterizing recombinant Caspase-10, researchers can better understand its functional role in apoptotic processes, explore its interactions with other proteins, and investigate its implications in disease mechanisms. This substrate is essential for studying caspase activation, understanding the apoptotic cascade, and developing targeted therapies that leverage apoptosis modulation. Thus, recombinant Caspase-10 serves as a valuable tool in both basic research and the development of novel therapeutic strategies in oncology and immunology.











