Analytical Data
-
Gene name
QPCT
-
简介
The QPCT protein plays a key role in pyroglutamyl peptide biosynthesis and exhibits substrate preference for N-terminal glutamine residues while showing specificity for residues near the N-terminus. Notably, its catalytic activity is independent of chain length beyond the second residue, emphasizing the importance of QPCT in the precise biosynthesis of pyroglutamyl peptides with diverse N-termini, contributing to various biological background. QPCT Protein, Mouse (HEK293, His) is the recombinant mouse-derived QPCT protein, expressed by HEK293 , with N-His, N-Myc labeled tag.
- Application
-
Alternative Names
Qpct; Glutaminyl-peptide cyclotransferase; EC 2.3.2.5; Glutaminyl cyclase; QC; Glutaminyl-tRNA cyclotransferase
-
Species
Mouse
-
Source
HEK293
-
Tag
N-His;N-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9CYK2-1
-
Expression Region
A36-L362
-
AA Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
41.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
QPCT (Quinone-Polyamine Cation Transporter) is a protein that plays a significant role in the transport of polyamines and other cationic substances across cell membranes. Understanding QPCT is crucial due to its involvement in various physiological processes, including cell growth, differentiation, and apoptosis. Moreover, dysregulation of polyamine transport mechanisms can lead to numerous pathologies, including cancer and neurodegenerative diseases. Research on QPCT has gained momentum as scientists aim to elucidate its structure, function, and regulatory mechanisms. The exploration of QPCT's interactions with cellular substrates and its role in different tissue types has important implications for developing therapeutic strategies. Advances in recombinant protein technology have facilitated the production of QPCT in sufficient quantities to study its biochemical properties and interactions. By employing techniques such as crystallography and cryo-electron microscopy, researchers are uncovering insights into the protein's transport mechanism and potential modulation pathways. As a result, QPCT is emerging as a promising target for novel drug development aimed at addressing conditions associated with altered polyamine levels. Overall, the study of QPCT not only enhances our understanding of fundamental cellular processes but also paves the way for future innovations in medical treatments for a range of diseases.











