Analytical Data
-
Gene name
KYAT1
-
简介
The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q16773-2
-
Expression Region
M1-L372
-
AA Sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
-
Protein Length
Full Length of Isoform-2
-
Molecular Weight
42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KYAT1, or kynurenine alpha-ketoglutarate transaminase 1, is an enzyme involved in the kynurenine pathway, which is crucial for tryptophan metabolism and the production of bioactive metabolites influencing various physiological processes. Research indicates that KYAT1 plays a significant role in modulating neurotransmitter levels, particularly serotonin, and may be linked to neurodevelopmental disorders and psychiatric diseases, including depression and schizophrenia. Its activity also impacts the production of neuroprotective compounds, making it a potential target for therapeutic intervention. Investigating the recombinant protein of KYAT1 allows for a deeper understanding of its enzymatic properties, regulatory mechanisms, and potential interactions with other metabolites. Utilizing recombinant techniques enhances our ability to produce and study KYAT1 in vitro, facilitating the exploration of its structure-function relationships and its role in pathophysiological conditions. As ongoing studies aim to elucidate the enzyme's function in health and disease, KYAT1 remains an important focus within the fields of biochemistry, pharmacology, and neurobiology, with the hope of discovering novel therapeutic strategies that can ameliorate conditions associated with dysregulated tryptophan metabolism and related disorders.
