Analytical Data
-
Gene name
SAG
-
简介
SAG proteins play a crucial role in phototransduction, regulating signal transduction by binding to light-activated and phosphorylated rhodopsin (RHO). It terminates RHO signaling by competitively interacting with G proteins at the same binding site on RHO. SAG Protein, Human (P.pastoris, His) is the recombinant human-derived SAG protein, expressed by P. pastoris , with N-6*His labeled tag.
- Application
-
Alternative Names
48kDa protein; Arrestin 1; Arrestin; ARRS_HUMAN; S antigen; S arrestin; S-AG; S-arrestin; SAG
-
Species
Human
-
Source
P. pastoris
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P10523
-
Expression Region
M1-E405
-
AA Sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
-
Protein Length
Full Length
-
Molecular Weight
47.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SAG (S-adenosyl-L-methionine-dependent methyltransferase) proteins have emerged as critical players in various biological processes, including regulation of gene expression, signal transduction, and protein modifications. Their pivotal role in methylation reactions implicates them in diverse physiological functions, such as development, cellular differentiation, and responses to environmental stimuli. Research on SAG proteins has gained traction due to their involvement in several diseases, including cancer, where aberrant methylation patterns can lead to tumorigenesis. The complexity of their interactions with other cellular molecules underscores the importance of understanding their structure and function. Advances in recombinant protein technology have enabled the production of SAG proteins in sufficient quantities for detailed biochemical studies, allowing researchers to explore their mechanisms of action and identify potential therapeutic targets. As the field progresses, the development of specific inhibitors and modulators targeting SAG proteins holds promise for novel treatment strategies, making them a focal point in both fundamental research and clinical applications. Understanding the intricate dynamics of SAG proteins in cellular contexts could pave the way for innovations in therapeutic interventions for diseases associated with dysregulated methylation processes.











