Analytical Data
-
Gene name
AICDA
-
简介
AICDA Protein, Mouse (His-Myc) is an enzyme that mediates affinity maturation and facilitates DNA demethylation in germinal center (GC) B cells. AICDA Protein overexpression causes more aggressive disease in BCL2-driven murine lymphomas.
- Application
-
Alternative Names
Aicda; Aid; Single-stranded DNA cytosine deaminase; EC 3.5.4.38; Activation-induced cytidine deaminase; AID; Cytidine aminohydrolase
-
Species
Mouse
-
Source
E. coli
-
Tag
N-10*His;C-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9WVE0
-
Expression Region
M1-F198
-
AA Sequence
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF
-
Protein Length
Full Length
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AICDA (activation-induced cytidine deaminase) is an essential enzyme involved in the somatic hypermutation and class switch recombination of immunoglobulin genes, playing a crucial role in the adaptive immune response. Research on AICDA has intensified due to its implications in both normal immune function and various diseases, including autoimmune disorders and cancers. AICDA facilitates the deamination of cytidine to uridine in DNA, leading to mutations that enhance the affinity of antibodies for their antigens, which is vital for effective immune defense. Aberrant activity of AICDA has been linked to the development of lymphomas and other hematological malignancies, highlighting the need for a deeper understanding of its mechanism and regulation. Moreover, AICDA's unique catalytic properties have garnered interest in biotechnology and therapeutic strategies, specifically in gene editing and vaccine development. The exploration of AICDA as a recombinant protein offers valuable insights into its structure-function relationship, enabling the design of novel inhibitors or modulators that could potentially lead to breakthroughs in treating diseases associated with AICDA dysregulation. Thus, ongoing studies into AICDA and its recombinant forms are pivotal to advancing our knowledge of immune mechanisms and developing innovative therapeutic approaches.











