Cat: IPD-X36864

Recombinant Human ST6GALNAC2 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ST6GALNAC2

  • 简介

    The ST6GALNAC2 protein is an essential enzyme that catalyzes the transfer of N-acetylneuramidyl groups to glycan chains in glycoproteins. This glycosyltransferase shows a preference for N-acetylgalactosamine (GalNAc) residues that have been modified by the addition of galactose or galactose followed by the addition of sialic acid in an α-2,3 linkage. ST6GALNAC2 Protein, Human (HEK293, His) is the recombinant human-derived ST6GALNAC2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Alpha-N-Acetylgalactosaminide Alpha-2; 6-Sialyltransferase 2; GalNAc Alpha-2; 6-Sialyltransferase II; ST6GalNAc II; ST6GalNAcII; SThM; Sialyltransferase 7B; SIAT7-B; ST6GALNAC2; SIAT7B; SIATL1; STHM

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UJ37

  • Expression Region

    S29-R374

  • AA Sequence

    SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR

  • Protein Length

    Lumenal Domain

  • Molecular Weight

    44.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ST6GALNAC2, a member of the ST6Gal family of glycosyltransferases, plays a crucial role in the biosynthesis of glycan structures on glycoproteins and glycolipids. This enzyme specifically transfers sialic acid to N-acetylgalactosamine (GalNAc) residues, resulting in the formation of complex sialylated structures that are vital for various biological processes, including cell-cell interactions, signal transduction, and immune response modulation. Aberrant expression of ST6GALNAC2 has been implicated in several pathological conditions, including cancer, where alterations in glycosylation patterns can influence tumor progression and metastasis. Furthermore, understanding the functional properties of ST6GALNAC2 can provide insights into its potential as a therapeutic target, as well as its involvement in diseases characterized by altered glycosylation. Recent advancements in recombinant protein technologies have enabled the production and characterization of ST6GALNAC2, allowing researchers to investigate its enzymatic activity, substrate specificity, and regulatory mechanisms. These studies are pivotal for elucidating the role of sialylated glycans in health and disease, thereby laying the groundwork for future explorations of glycosyltransferases in clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US