Analytical Data
-
Gene name
SULT1C2
-
简介
The SULT1C2 protein utilizes PAPS to catalyze sulfate conjugation and has specific affinity for sulfonated p-nitrophenol. It selectively avoids sulfonated steroids, dopamine, acetaminophen or alpha-naphthol. SULT1C2 Protein, Human (His) is the recombinant human-derived SULT1C2 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
Sulfotransferase 1C2; ST1C2; Sulfotransferase 1C1; SULT1C#1; humSULTC2; SULT1C2; SULT1C1;
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00338
-
Expression Region
M1-L296
-
AA Sequence
MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
-
Protein Length
Full Length
-
Molecular Weight
38.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT1C2, a member of the sulfotransferase enzyme family, plays a crucial role in the metabolism of various endogenous and exogenous compounds by catalyzing the transfer of sulfate groups. Research on SULT1C2 is particularly significant due to its involvement in the biotransformation of drugs, hormones, and neurotransmitters, influencing their pharmacokinetics and pharmacodynamics. Its activity can modulate the bioavailability and toxicity of many substances, making it an essential target for understanding individual differences in drug response and the development of pharmacogenomic strategies. The study of SULT1C2 also extends to its role in steroid biosynthesis and metabolism, where it may impact reproductive health and developmental processes. Recent advances in recombinant DNA technology have facilitated the production of recombinant SULT1C2 proteins, enabling detailed biochemical and structural studies. These efforts aim to elucidate the enzyme's substrate specificity, catalytic mechanisms, and regulatory pathways, which can ultimately contribute to the development of therapeutic interventions and the assessment of drug interactions. Understanding the functional implications of SULT1C2 is pivotal not only for pharmacology but also for personalized medicine approaches, wherein individual variations in sulfation capacities can influence treatment efficacy and safety profiles.
