Cat: IPD-X32169

Recombinant Rat Anionic trypsin-2 Protein (P. pastoris),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Anionic trypsin-2

  • 简介

    Anionic trypsin-2 belongs to the trypsin family of serine proteases and encodes anionic trypsinogen.Anionic trypsin-2 is part of a cluster of trypsinogen genes that are located within the T cell receptor beta locus.Anionic trypsin-2 Protein, Rat (P.pastoris, His) is the recombinant rat-derived Anionic trypsin-2 protein, expressed by P.pastoris , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Prss2; Try2; Anionic trypsin-2; EC 3.4.21.4; Anionic trypsin II; Pretrypsinogen II; Serine protease 2

  • Species

    Rat

  • Source

    P. pastoris

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P00763

  • Expression Region

    I24-N246

  • AA Sequence

    IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Anionic trypsin-2 is a serine protease that plays a crucial role in various physiological processes, including digestion, blood coagulation, and inflammation. The study of this enzyme has garnered significant interest due to its unique biochemical properties and potential applications in biomedical research and therapeutic interventions. As a member of the trypsin family, anionic trypsin-2 exhibits a specific substrate preference for basic amino acids, making it vital for protein digestion in the small intestine. Moreover, its involvement in regulating peptide signaling pathways underscores its relevance in health and disease states, including cancer and autoimmune disorders. The recombinant production of anionic trypsin-2 allows researchers to obtain the enzyme in a controlled manner for detailed structural and functional studies. Understanding the enzyme's catalytic mechanisms and substrate interactions can reveal insights into protein processing and the development of enzyme inhibitors. Furthermore, the generation of modified forms of anionic trypsin-2 could lead to innovations in drug design and the advancement of therapeutic strategies, particularly for conditions associated with protease dysregulation. Overall, the research on anionic trypsin-2 contributes significantly to our understanding of protease biology and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US